Edit |   |
---|---|
Antigenic Specificity | AP3S1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-AP3S1 polyclonal antibody, unconjugated |
Immunogen | AP3 S1 antibody was raised using the N terminal of AP3 1 corresponding to a region with amino acids IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE |
Other Names | CLAPS3|Sigma3A|AP-3 complex sigma-3A subunit|AP-3 complex subunit sigma-1|AP-3 complex subunit sigma-3A|adapter-related protein complex 3 sigma-1 subunit|clathrin-associatedassemblyadapter protein|small 3|clathrin-associatedassemblyadaptor protein|small 3 (22kD)|sigma-3A-adaptin|sigma-adaptin 3a|sigma3A-adaptin|adaptor related protein complex 3 sigma 1 subunit|AP3S1|Adaptor-Related Protein Complex 3, sigma 1 Subunit|s3A|adaptor-related protein complex AP-3|sigma 1 subunit|sigma 3A-adaptin|adaptor related protein complex 3 sigma 1 subunit S homeolog|ap3s1.S|wu:fa92f10|zgc:101869 |
Gene, Accession # | Gene ID: 1176, 11777, 302290 |
Catalog # | ABIN632399 |
Price | $1020 |
Order / More Info | AP3S1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |