Edit |   |
---|---|
Antigenic Specificity | CPSF2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CPSF2 polyclonal antibody, unconjugated |
Immunogen | CPSF2 antibody was raised using the N terminal of CPSF2 corresponding to a region with amino acids YAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVDAA |
Other Names | CPSF100|CPSF 100 kDa subunit|CPSF 100kDa subunit|cleavage and polyadenylation specificity factor 100 kDa subunit|cleavage and polyadenylation specificity factor subunit 2|cleavage and polyadenylation specific factor 2|CPSF2|Cleavage and Polyadenylation Specific Factor 2, 100kDa|100kDa|2610024B04Rik|AI662483|Cpsf|MCPSF|mKIAA1367|100kD subunit|zgc:92484|PAAG_07931|cpsf2-A|cleavage and polyadenylation specific factor 2 S homeolog|cpsf2.S|LOC582050|LOC100157277|LOC100179344 |
Gene, Accession # | Gene ID: 51786, 53981, 299256 |
Catalog # | ABIN633438 |
Price | $1020 |
Order / More Info | CPSF2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |