Edit |   |
---|---|
Antigenic Specificity | CGRP |
Clone | polyclonal |
Host Species | Goat |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | n/a |
Applications | Radioimmunoassay |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Goat anti-CGRP polyclonal antibody, unconjugated |
Immunogen | Synthetic human Calcitonin Gene-related Peptide, bTG-conjugated (acntatcvthrlagllsrsggmvksnfvptnvgskaf) |
Other Names | CALC1|CGRP|CGRP-I|CGRP1|CT|KC|alpha-type CGRP|calcitonin|calcitonin 1|calcitonin gene-related peptide I|calcitonincalcitonin-related polypeptide|alpha|katacalcin|calcitonin related polypeptide alpha|CALCA|Calcitonin-Related Polypeptide alpha|CALC|calcitonin gene-related peptide|calcitonin related polypeptide beta|CALCB|CALC3|calcitonin gene-related peptide 2|calcitonin-related polypeptide 3|ci-ct|calcitonin/calcitonin-related polypeptide, alpha|CA|CGRP-1|Ctn|alpha CGRP|calcitonin gene-related peptide 1|calcitoninalpha CGRP|CAL6|Cal1|RATCAL6|calcitonin-related polypeptide|beta|calcitonin-related polypeptide beta|LOC100008771|CGRPI|calcitonin gene related peptide I|zgc:92886 |
Gene, Accession # | Gene ID: 796 |
Catalog # | ABIN109808 |
Price | $554 |
Order / More Info | CGRP Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |