Edit |   |
---|---|
Antigenic Specificity | S100A9 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-S100A9 polyclonal antibody, unconjugated |
Immunogen | S100 A9 antibody was raised using the N terminal of S100 9 corresponding to a region with amino acids MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK |
Other Names | 60B8AG|CAGB|CFAG|CGLB|L1AG|LIAG|MAC387|MIF|MRP14|NIF|P14|MRP-14|S100 calcium-binding protein A9 (calgranulin B)|calgranulin B|calgranulin-B|calprotectin L1H subunit|leukocyte L1 complex heavy chain|migration inhibitory factor-related protein 14|protein S100-A9|S100 calcium binding protein A9|S100A9|S100 calcium binding protein A9 (calgranulin B)|intracellular calcium-binding protein (MRP14)|myeloid-related protein 14|protein MRP-126|BEE22|S100 calcium-binding protein A9|neutrophil cytosolic 23 kDa protein|p23|RNA-binding region containing protein 2-like|calprotectin|AW546964|GAGB |
Gene, Accession # | Gene ID: 6280 |
Catalog # | ABIN634289 |
Price | $1020 |
Order / More Info | S100A9 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |