Edit |   |
---|---|
Antigenic Specificity | ATP6V0A2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ATP6V0A2 polyclonal antibody, unconjugated |
Immunogen | ATP6 V6 2 antibody was raised using the N terminal of ATP6 6 2 corresponding to a region with amino acids INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
Other Names | A2|ARCL|ARCL2A|ATP6A2|ATP6N1D|J6B7|RTF|STV1|TJ6|TJ6M|TJ6S|VPH1|WSS|A2V-ATPase|V-type proton ATPase 116 kDa subunit a isoform 2|lysosomal H(+)-transporting ATPase V0 subunit a2|regeneration and tolerance factor|v-ATPase 116 kDa|v-type proton ATPase 116 kDa subunit a|vacuolar proton translocating ATPase 116 kDa subunit a|ATPase H+ transporting V0 subunit a2|ATP6V0A2|ATPase, H+ Transporting, Lysosomal V0 Subunit A2|8430408C20Rik|AI385560|AW489264|Atp6n2|C76904|ISF|SHIF|V-ATPase a2|ATPase|H+ transporting|lysosomal (vacuolar proton pump) non-catalytic accessory protein 2 (38kD)|lysosomal V0 subunit a|T-cell expressing clone j6|immune suppressor factor J6B7|Cc1-3|si:ch211-199i18.4|lysosomal V0 subunit a2|ATPase, H+ transporting, lysosomal V0 subunit a2a|atp6v0a2a|vacuolar H(+)-transporting ATPase 116 kDa subunit|a2 isoform|vacuolar proton translocating ATPase 116-kDa subunit a2|si:ch211-106a19.2|ATPase, H+ transporting, lysosomal V0 subunit a2b|atp6v0a2b |
Gene, Accession # | Gene ID: 21871, 23545, 116455 |
Catalog # | ABIN634572 |
Price | $1020 |
Order / More Info | ATP6V0A2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |