Edit |   |
---|---|
Antigenic Specificity | SLC22A13 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SLC22A13 polyclonal antibody, unconjugated |
Immunogen | SLC22 A13 antibody was raised using the N terminal of SLC22 13 corresponding to a region with amino acids FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM |
Other Names | OAT10|OCTL1|OCTL3|ORCTL-3|ORCTL3|organic cation transporter-like 3|organic cationic transporter-like 3|organic-cation transporter like 3|solute carrier family 22 (organic anion transporter)|member 13|solute carrier family 22 member 13|solute carrier family 22|SLC22A13|Solute Carrier Family 22 (Organic Anion Transporter), Member 13|solute carrier family 22 (organic cation transporter)|AI648912|solute carrier family 22 (organic cation transporter), member 13|solute carrier family 22 (organic anionurate transporter) |
Gene, Accession # | Gene ID: 9390, 102570, 316062 |
Catalog # | ABIN635939 |
Price | $1020 |
Order / More Info | SLC22A13 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |