Edit |   |
---|---|
Antigenic Specificity | PFDN6 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PFDN6 polyclonal antibody, unconjugated |
Immunogen | PFDN6 antibody was raised using the N terminal of PFDN6 corresponding to a region with amino acids MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL |
Other Names | H2-KE2|HKE2|KE-2|PFD6|HLA class II region expressed gene KE2|KE2 protein|prefoldin subunit 6|PFDN6|pfdn6a|prefoldin subunit 6 a|prefoldin subunit 6 S homeolog|pfdn6.S|prefoldin subunit 6 (predicted)|SPAC3A11.13|23.m05913|BBOV_IV004800|AOR_1_2254174|CMU_042830|H-2Ke2|protein Ke2|Ke2|MHC class II region expressed gene KE2|prefoldin 6|zgc:66282|pfdn6b|prefoldin subunit 6 b|prefoldin subunit 6 L homeolog|pfdn6.L |
Gene, Accession # | Gene ID: 10471, 14976, 309629, 474872 |
Catalog # | ABIN631922 |
Price | $1020 |
Order / More Info | PFDN6 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |