Edit |   |
---|---|
Antigenic Specificity | AP1m2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-AP1m2 polyclonal antibody, unconjugated |
Immunogen | AP1 M2 antibody was raised using the N terminal of AP1 2 corresponding to a region with amino acids MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL |
Other Names | ap1m1|adaptor-related protein complex 1|mu 1 subunit|adaptor related protein complex 1 mu 2 subunit L homeolog|ap1m2.L|Adaptor-Related Protein Complex 1, mu 2 Subunit|AP1m2|zgc:103537|AP-1 complex subunit mu-2|mu 2 subunit|adaptor related protein complex 1 mu 2 subunit|AP-1 complex subunit mu-2-like|AP1-mu2|HSMU1B|MU-1B|MU1B|mu2|AP-mu chain family member mu1B|HA1 47 kDa subunit 2|adaptor protein complex AP-1 mu-2 subunit|adaptor-related protein complex 1 mu-2 subunit|clathrin assembly protein complex 1 medium chain 2|clathrin coat assembly protein AP47 2|clathrin coat associated protein AP47 2|clathrin-associated adaptor medium chain mu2|golgi adaptor AP-1 47 kDa protein|golgi adaptor HA1AP1 adaptin mu-2 subunit|mu-adaptin 2|mu1B-adaptin|D9Ertd818e|m1B|adaptor-related protein complex AP-1|adaptor protein complex AP-1, mu 2 subunit|RGD1561490|adaptor protein complex AP-1 |
Gene, Accession # | Gene ID: 10053 |
Catalog # | ABIN633108 |
Price | $1020 |
Order / More Info | AP1m2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |