Edit |   |
---|---|
Antigenic Specificity | PCDH15 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PCDH15 polyclonal antibody, unconjugated |
Immunogen | PCDH15 antibody was raised using the N terminal of PCDH15 corresponding to a region with amino acids HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP |
Other Names | CDHR15|DFNB23|USH1F|cadherin-related family member 15|protocadherin-15|protocadherin related 15|PCDH15|CpipJ_CPIJ005081|BB078305|ENSMUSG00000046980|Gm9815|av|nmf19|Ames waltzer|protocadherin 15 CD2|protocadherin 15 CD3 isoform|protocadherin 15|protocadherin-15-CD3 |
Gene, Accession # | Gene ID: 11994, 690865 |
Catalog # | ABIN635568 |
Price | $1020 |
Order / More Info | PCDH15 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |