Edit |   |
---|---|
Antigenic Specificity | C6orf134 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-C6orf134 polyclonal antibody, unconjugated |
Immunogen | C6 ORF134 antibody was raised using the N terminal Of C6 rf134 corresponding to a region with amino acids MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL |
Other Names | C6orf134|MEC17|Nbla00487|TAT|acetyltransferase mec-17 homolog|alpha-TAT|alpha-tubulin N-acetyltransferase|alpha tubulin acetyltransferase 1|ATAT1|Chromosome 6 Open Reading Frame 134|wu:fj19c03|zgc:65893|zgc:77443|MEChanosensory abnormality homolog|alpha tubulin acetyltransferase 1 S homeolog|atat1.S|C23H6orf134|0610011P08Rik|2610008K08Rik|2610110G12Rik|3110080J08Rik|Novel DUF738 containing protein (2610110G12Rik)|RGD1303066|C7H6ORF134|C4H6orf134|alpha-tubulin N-acetyltransferase 1 |
Gene, Accession # | Gene ID: 73242, 79969, 361789 |
Catalog # | ABIN629855 |
Price | $902 |
Order / More Info | C6orf134 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |