Edit |   |
---|---|
Antigenic Specificity | HNRNPK |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-HNRNPK polyclonal antibody, unconjugated |
Immunogen | HNRPK antibody was raised using the N terminal of HNRPK corresponding to a region with amino acids NTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKG |
Other Names | CSBP|HNRPK|TUNP|dC-stretch binding protein|transformation upregulated nuclear protein|heterogeneous nuclear ribonucleoprotein K|HNRNPK|dC stretch-binding protein|hnRNP K|heterogeneous nuclear ribonucleoprotein K S homeolog|hnrnpk.S|MGC75642|wu:fb37h02|wu:fi34c04|zgc:66162|LOC5565718|CpipJ_CPIJ000130|NGK_p0004|hnRNP-K protein|KBBP|NOVA|heterogeneous nuclear ribonucleoprotein K-like |
Gene, Accession # | Gene ID: 3190, 15387, 117282, 100855638 |
Catalog # | ABIN633224 |
Price | $1020 |
Order / More Info | HNRNPK Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |