Edit |   |
---|---|
Antigenic Specificity | RASGEF1C |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RASGEF1C polyclonal antibody, unconjugated |
Immunogen | RASGEF1 C antibody was raised using the middle region of RASGEF1 corresponding to a region with amino acids FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE |
Other Names | ras-GEF domain-containing family member 1C|RasGEF domain family member 1C|RASGEF1C|RasGEF Domain Family, Member 1C|9130006A14Rik|RasGEF domain family|member 1C|ras-GEF domain-containing family member 1C-like |
Gene, Accession # | Gene ID: 74563, 255426, 360519 |
Catalog # | ABIN634380 |
Price | $1020 |
Order / More Info | RASGEF1C Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |