Edit |   |
---|---|
Antigenic Specificity | RHBDF1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RHBDF1 polyclonal antibody, unconjugated |
Immunogen | RHBDF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR |
Other Names | C16orf8|Dist1|EGFR-RS|gene-89|gene-90|hDist1|epidermal growth factor receptor|related sequence|epidermal growth factor receptor-related protein|iRhom1|inactive rhomboid protein 1|p100hRho|rhomboid family 1|rhomboid family member 1|rhomboid 5 homolog 1|RHBDF1|rhomboid 5 homolog 1 (Drosophila)|rhomboid family member 1-like|Dist|mKIAA4242|epidermal growth factor receptor related sequence|zgc:91984|rhomboid 5 homolog 1a (Drosophila)|rhbdf1a |
Gene, Accession # | Gene ID: 13650, 64285, 303008 |
Catalog # | ABIN635205 |
Price | $1020 |
Order / More Info | RHBDF1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |