Edit |   |
---|---|
Antigenic Specificity | KIF22 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-KIF22 polyclonal antibody, unconjugated |
Immunogen | KIF22 antibody was raised using the N terminal of KIF22 corresponding to a region with amino acids CSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNA |
Other Names | A-328A3.2|KID|KNSL4|OBP|OBP-1|OBP-2|SEMDJL2|kinesin-like DNA-binding protein pseudogene|kinesin-like protein 4|kinesin-like protein KIF22|oriP binding protein|origin of plasmid DNA replication-binding protein|kinesin family member 22|KIF22|T1E22.130|T1E22_130|ATP binding microtubule motor family protein|AT5G02370|DKFZp459I1739|kinesin-like protein KIF22-like|AU021460|C81217|Kif22a|kinesin family member 22A|zgc:171724|zKIF22|kid-b|kif22-b|kiff22-b|kiff22b|chromokinesin kid-b|kinesin family member 22 b|kinesin-like protein KIF22-B|xkid-B|kif22-a |
Gene, Accession # | Gene ID: 3835 |
Catalog # | ABIN634122 |
Price | $1020 |
Order / More Info | KIF22 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |