Edit |   |
---|---|
Antigenic Specificity | CACHD1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CACHD1 polyclonal antibody, unconjugated |
Immunogen | CACHD1 antibody was raised using the N terminal of CACHD1 corresponding to a region with amino acids HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA |
Other Names | RP4-655E10.1|VWFA and cache domain-containing protein 1|cache domain-containing protein 1|von Willebrand factor type A and cache domain containing 1|cache domain containing 1|CACHD1|RGD1310770|1190007F10Rik|AI852726|B430218L07Rik|Vwcd1|mKIAA1573|VWFA and cache domain-containing protein 1-like|LOC593655 |
Gene, Accession # | Gene ID: 57685, 298267, 320508 |
Catalog # | ABIN635475 |
Price | $1020 |
Order / More Info | CACHD1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |