Edit |   |
---|---|
Antigenic Specificity | PIK3R5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PIK3R5 polyclonal antibody, unconjugated |
Immunogen | PIK3 R5 antibody was raised using the N terminal of PIK3 5 corresponding to a region with amino acids HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSS |
Other Names | F730038I15Rik|FOAP-2|P101-PI3K|p101|PI3-kinase p101 subunit|phosphatidylinositol 4|5-bisphosphate 3-kinase regulatory subunit|phosphatidylinositol-4|phosphoinositide 3-kinase regulatory subunit 5|protein FOAP-2|ptdIns-3-kinase p101|phosphoinositide-3-kinase regulatory subunit 5|PIK3R5|Phosphoinositide-3-Kinase, Regulatory Subunit 5|AV230647|PI3-kinase regulatory subunit 5|ptdIns-3-kinase regulatory subunit|RGD1563261|phosphoinositide-3-kinase|regulatory subunit 5|phosphoinositide-3-kinase regulatory subunit 5 S homeolog|pik3r5.S|IB PI3-kinase p101 subunit|fc03h05|si:ch73-203d16.1|wu:fc03h05 |
Gene, Accession # | Gene ID: 23533, 320207, 497931 |
Catalog # | ABIN632989 |
Price | $1020 |
Order / More Info | PIK3R5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |