Edit |   |
---|---|
Antigenic Specificity | GRIK2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-GRIK2 polyclonal antibody, unconjugated |
Immunogen | GRIK2 antibody was raised using the N terminal of GRIK2 corresponding to a region with amino acids PDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLK |
Other Names | EAA4|GLR6|GLUK6|GLUR6|GluK2|MRT6|bA487F5.1|excitatory amino acid receptor 4|gluR-6|glutamate receptor 6|glutamate receptor form A|glutamate receptor form B|glutamate receptor form C|glutamate receptor form D|glutamate receptor form E|glutamate receptor ionotropic|kainate 2|glutamate ionotropic receptor kainate type subunit 2|GRIK2|Glutamate Receptor, Ionotropic, Kainate 2|AW124492|Glurbeta2|gluR beta-2|glutamate receptor beta-2|glutamate receptor|ionotropic kainate 2|glutamate receptor, ionotropic, kainate 2 (beta 2)|grik2-A|GRIK5|ionotropic|kainate 5|glutamate receptor, ionotropic, kainate 2 L homeolog|grik2.L |
Gene, Accession # | Gene ID: 2898, 14806, 54257, 481938 |
Catalog # | ABIN630095 |
Price | $902 |
Order / More Info | GRIK2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |