Edit |   |
---|---|
Antigenic Specificity | DAO |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-DAO polyclonal antibody, unconjugated |
Immunogen | ABP1 antibody was raised using the C terminal of ABP1 corresponding to a region with amino acids QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF |
Other Names | ABP|ABP1|DAO|DAO1|KAO|amiloride binding protein 1 (amine oxidase (copper-containing))|amiloride-sensitive amine oxidase|amiloride-sensitive amine oxidase copper-containing|diamine oxidase|histaminase|kidney amine oxidase|amine oxidase, copper containing 1|AOC1|1600012D06Rik|amiloride binding protein 1 (amine oxidase|copper-containing)|amiloride-binding protein|amine oxidase, copper-containing 1|si:ch211-286c5.2|zgc:154101|amiloride-sensitive amine oxidase copper-containing-like|amiloride binding proteindiamine oxidase |
Gene, Accession # | Gene ID: 26 |
Catalog # | ABIN634013 |
Price | $1020 |
Order / More Info | DAO Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |