Edit |   |
---|---|
Antigenic Specificity | MFRP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-MFRP polyclonal antibody, unconjugated |
Immunogen | MFRP antibody was raised using the N terminal of MFRP corresponding to a region with amino acids TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE |
Other Names | MCOP5|NNO2|RD6|membrane-type frizzled-related protein|membrane frizzled-related protein|MFRP|C1q and TNF related 5|C1QTNF5|membrane frizzled-related protein-like |
Gene, Accession # | Gene ID: 83552 |
Catalog # | ABIN635098 |
Price | $1020 |
Order / More Info | MFRP Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |