Edit |   |
---|---|
Antigenic Specificity | RBM4B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RBM4B polyclonal antibody, unconjugated |
Immunogen | RBM4 B antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL |
Other Names | RBM30|RBM4L|ZCCHC15|ZCCHC21B|ZCRB3B|RNA binding motif protein 30|RNA-binding motif protein 30|RNA-binding motif protein 4B|RNA-binding protein 30|RNA-binding protein 4B|zinc finger CCHC-type and RNA binding motif 3B|RNA binding motif protein 4B|RBM4B|4921506I22Rik|AI504630|AI506404|Lark2|rbm4|MGC75893|RNA binding motif protein 4|zinc responsive protein ZD7|zinc-responsive protein ZD7|RNA binding motif protein 4B L homeolog|rbm4b.L|LOC713553|RNA-binding protein 4B-like|LOC102180196|LOC100058729 |
Gene, Accession # | Gene ID: 83759 |
Catalog # | ABIN630027 |
Price | $902 |
Order / More Info | RBM4B Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |