Edit |   |
---|---|
Antigenic Specificity | C20orf111 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-C20orf111 polyclonal antibody, unconjugated |
Immunogen | C20 ORF111 antibody was raised using the N terminal Of C20 rf111 corresponding to a region with amino acids RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG |
Other Names | C20orf111|HSPC207|Osr1|Perit1|dJ1183I21.1|oxidative stress-responsive 1|oxidative stress-responsive protein 1|oxidative stress-responsive serine-rich protein 1|peroxide-inducible transcript 1 protein|oxidative stress responsive serine rich 1|OSER1|Chromosome 20 Open Reading Frame 111|MGC76290|hypothetical protein LOC394513|oxidative stress responsive serine-rich 1|oxidative stress responsive 1|uncharacterized protein C20orf111 homolog|oxidative stress responsive serine-rich 1 L homeolog|oser1.L|MGC134505|DKFZp468B2423 |
Gene, Accession # | Gene ID: 51526 |
Catalog # | ABIN632921 |
Price | $1020 |
Order / More Info | C20orf111 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |