Edit |   |
---|---|
Antigenic Specificity | SLC25A14 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SLC25A14 polyclonal antibody, unconjugated |
Immunogen | SLC25 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV |
Other Names | BMCP1|UCP5|brain mitochondrial carrier protein 1|mitochondrial uncoupling protein 5|solute carrier family 25 member 14|SLC25A14|Solute Carrier Family 25 (Mitochondrial Carrier, Brain), Member 14|solute carrier family 25 (mitochondrial carrier|brain)|member 14|ATPUMP5|DIC1|DICARBOXYLATE CARRIER 1|F14M13.10|F14M13_10|PLANT UNCOUPLING MITOCHONDRIAL PROTEIN 5|uncoupling protein 5|UCP5L|UCP5S|BMCP-1|UCP 5|zgc:55596|solute carrier family 25 |
Gene, Accession # | Gene ID: 9016, 20523, 85263, 612910 |
Catalog # | ABIN630323 |
Price | $902 |
Order / More Info | SLC25A14 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |