Edit |   |
---|---|
Antigenic Specificity | Albumin |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Albumin polyclonal antibody, unconjugated |
Immunogen | Albumin antibody was raised using the N terminal of ALB corresponding to a region with amino acids YGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEET |
Other Names | PRO0883|PRO0903|PRO1341|albumin (32 AA)|albumin (AA 34)|cell growth inhibiting protein 42|growth-inhibiting protein 20|serum albumin|albumin|ALB|BSA|CSA|alpha-livetin|preproalbumin (serum albumin)|Alb-1|Alb1|albumin 1|Albza|preproalbumin|LOC100136344|serum albumin 1|pre-pro serum albumin|Qlv-U377A-G8|alb-a|alb-b|74 kDa serum albumin|serum albumin B|albumin S homeolog|alb.S |
Gene, Accession # | Gene ID: 85302 |
Catalog # | ABIN633959 |
Price | $1020 |
Order / More Info | Albumin Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |