Edit |   |
---|---|
Antigenic Specificity | CHCHD4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CHCHD4 polyclonal antibody, unconjugated |
Immunogen | CHCHD4 antibody was raised using the N terminal of CHCHD4 corresponding to a region with amino acids MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNIN |
Other Names | 2410012P20Rik|2810014D17Rik|AI838740|coiled-coil-helix-coiled-coil-helix domain-containing protein 4|mitochondrial intermembrane space import and assembly protein 40|coiled-coil-helix-coiled-coil-helix domain containing 4|Chchd4|MIA40|TIMM40|mitochondrial intermembrane space import and assembly 40 homolog|translocase of inner mitochondrial membrane 40 homolog|chchd4a|coiled-coil-helix-coiled-coil-helix domain-containing protein 4-A|mitochondrial intermembrane space import and assembly protein 40-A|coiled-coil-helix-coiled-coil-helix domain containing 4 L homeolog|chchd4.L|fc10g04|si:dkey-202e22.1|wu:fc10g04|zgc:100849|coiled-coil-helix-coiled-coil-helix domain containing 4a|chchd4b|coiled-coil-helix-coiled-coil-helix domain-containing protein 4-B|mitochondrial intermembrane space import and assembly protein 40-B|coiled-coil-helix-coiled-coil-helix domain containing 4 S homeolog|chchd4.S|LOC100361898|CaO19.2977|Mitochondrial import inner membrane translocase TIM40|Mia40p |
Gene, Accession # | Gene ID: 72170, 312559 |
Catalog # | ABIN631099 |
Price | $1020 |
Order / More Info | CHCHD4 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |