Edit |   |
---|---|
Antigenic Specificity | SLC43A3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SLC43A3 polyclonal antibody, unconjugated |
Immunogen | SLC43 A3 antibody was raised using the N terminal of SLC43 3 corresponding to a region with amino acids MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD |
Other Names | EEG1|FOAP-13|PRO1659|SEEEG-1|likely ortholog of mouse embryonic epithelial gene 1|solute carrier family 43 member 3|SLC43A3|Solute Carrier Family 43, Member 3|embryonic epithelia gene 1 protein|embryonic epithelial gene 1|selectively expressed in embryonic epithelia protein-1|solute carrier family 43|member 3|solute carrier family 43 member 3-like|zgc:136890|solute carrier family 43, member 3b|slc43a3b |
Gene, Accession # | Gene ID: 29015 |
Catalog # | ABIN630461 |
Price | $902 |
Order / More Info | SLC43A3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |