Edit |   |
---|---|
Antigenic Specificity | NUP35 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-NUP35 polyclonal antibody, unconjugated |
Immunogen | NUP35 antibody was raised using the C terminal of NUP35 corresponding to a region with amino acids STPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW |
Other Names | MP44|NP44|NUP53|35 kDa nucleoporin|MP-44|mitotic phosphoprotein 44|nuclear pore complex protein Nup53|nucleoporin NUP53|nucleoporin Nup35|nucleoporin 35|NUP35|Nucleoporin 35kDa|2310006I24Rik|35kDa|5330402E05Rik|NO44|fj68d11|wu:fj68d11|zgc:65979|MGC64281|nucleoporin 35kDa L homeolog|nup35.L|CpipJ_CPIJ009421|nucleoporin NUP53-like protein|nucleoporin NUP53-like |
Gene, Accession # | Gene ID: 69482, 129401, 295692 |
Catalog # | ABIN630746 |
Price | $1020 |
Order / More Info | NUP35 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |