Edit |   |
---|---|
Antigenic Specificity | GJA3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-GJA3 polyclonal antibody, unconjugated |
Immunogen | GJA3 antibody was raised using the N terminal of GJA3 corresponding to a region with amino acids ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS |
Other Names | CTRCT14|CX46|CZP3|connexin 46|connexin-46|gap junction alpha-3 protein|gap junction protein alpha 3|GJA3|Gap Junction Protein, alpha 3, 46kDa|Cnx46|Cx43|Gja-3|alpha 3 connexin|gap junction membrane channel protein alpha 3|gap junction protein, alpha 3|MGC53082|alpha3 connexin|gap junction protein|alpha 3|46kDa|MGC69466 protein L homeolog|MGC69466.L|connexin-56|cx56|46kDa (connexin 46)|connexin-44|cx44|gap junction alpha-3 protein-like|cx48.5|connexin 48.5|dco|dococ|unm s215|unm s226 |
Gene, Accession # | Gene ID: 2700 |
Catalog # | ABIN634674 |
Price | $1020 |
Order / More Info | GJA3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |