Edit |   |
---|---|
Antigenic Specificity | H2AFX |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-H2AFX polyclonal antibody, unconjugated |
Immunogen | H2 AFX antibody was raised using the N terminal of H2 FX corresponding to a region with amino acids SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY |
Other Names | H2A.X|H2AX|H2AX|H2AX histone|histone H2A.x|H2A histone family member X|H2AFX|H2A Histone Family, Member X|AW228881|Hist5-2ax|gammaH2ax|histone 5 protein 2ax|h2a|histone cluster 2, H2ab S homeolog|hist2h2ab.S|histone cluster 1, H2ah|HIST1H2AH|RGD1566119|zgc:56329|histone H2A type 1|H2A histone family member X L homeolog|h2afx.L|histone H2AX|LOC100522201|LOC100720536 |
Gene, Accession # | Gene ID: 3014, 15270, 500987 |
Catalog # | ABIN630601 |
Price | $1020 |
Order / More Info | H2AFX Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |