Edit |   |
---|---|
Antigenic Specificity | SRD5A3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SRD5A3 polyclonal antibody, unconjugated |
Immunogen | SRD5 A3 antibody was raised using the N terminal of SRD5 3 corresponding to a region with amino acids GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN |
Other Names | CDG1P|CDG1Q|KRIZI|SRD5A2L|SRD5A2L1|3-oxo-5-alpha-steroid 4-dehydrogenase 3|S5AR 3|SR type 3|polyprenol reductase|probable polyprenol reductase|steroid 5 alpha-reductase 3|SRD5A3|1110025P14Rik|A430076C09|AV364670|AW987574|D730040M03Rik|H5ar|steroid 5 alpha-reductase 2 like|steroid 5 alpha-reductase 2-like; H5AR gene; steroid 5 alpha-reductase 2 like|steroid 5-alpha-reductase 3|RGD1308828|SRD5alpha3|steroid 5 alpha-reductase 3 S homeolog|srd5a3.S|fj40g12|si:ch211-278f21.3|wu:fj40g12 |
Gene, Accession # | Gene ID: 57357, 79644, 305291 |
Catalog # | ABIN636011 |
Price | $1020 |
Order / More Info | SRD5A3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |