Edit |   |
---|---|
Antigenic Specificity | SOD2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SOD2 polyclonal antibody, unconjugated |
Immunogen | SOD2 antibody was raised using the N terminal of SOD2 corresponding to a region with amino acids MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH |
Other Names | IPOB|MNSOD|MVCD6|Mn superoxide dismutase|indophenoloxidase B|manganese-containing superoxide dismutase|mangano-superoxide dismutase|superoxide dismutase Mn|mitochondrial|superoxide dismutase 2|SOD2|Superoxide Dismutase 2, Mitochondrial|Sod-2|manganese SOD|manganese superoxide dismutase|BDBG_07234|LOC100101896|SOD|Superoxide dimutase 2|mitochondrial superoxide dismutase 2|cb463|wu:fj33b01|zgc:73051|Mn-SOD|sod(Mn)|superoxide dismutase 2 L homeolog|sod2.L|GB14346|Mn Sod|MGC88869|LbMnSOD4|GRMZM5G891739|LOC100282741|CG8905|DmelCG8905|Mito SOD|Mn-SOD2|MnSODII|Mn2+SOD|dSOD2|mitSOD2|CG8905-PA|Mn-superoxide dismutase|Sod2-PA|manganese-SOD|mitochodnrial SOD|mitochondrial Mn-superoxide dismutase 2|mitochondrial MnSOD|superoxide dismutase|superoxide dismutase 2 (Mn)|superoxide dismutase-2|superoxide dismutase (Mn type)|Superoxide dismutase [Mn] 1, mitochondrial|manganous superoxide dismutase |
Gene, Accession # | Gene ID: 6648 |
Catalog # | ABIN634322 |
Price | $1020 |
Order / More Info | SOD2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |