Edit |   |
---|---|
Antigenic Specificity | KLRC3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-KLRC3 polyclonal antibody, unconjugated |
Immunogen | KLRC3 antibody was raised using the N terminal of KLRC3 corresponding to a region with amino acids MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASL |
Other Names | NKG2-E|NKG2E|NK cell receptor E|NKG2-E type II integral membrane protein|NKG2-E-activating NK receptor|killer cell lectin like receptor C3|KLRC3|Killer Cell Lectin-Like Receptor Subfamily C, Member 3|Klrc2|killer cell lectin-like receptor subfamily C|member 2|natural killer cell group 2E cell receptor|member 3|NKG2-C|NKG2-C2|NKG2C|CD159 antigen-like family member C|NK cell receptor C|NKG2-C type II integral membrane protein|NKG2-C-activating NK receptor|NKG2-Ce2 |
Gene, Accession # | Gene ID: 3823 |
Catalog # | ABIN635416 |
Price | $1020 |
Order / More Info | KLRC3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |