Edit |   |
---|---|
Antigenic Specificity | TRAF7 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TRAF7 polyclonal antibody, unconjugated |
Immunogen | TRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR |
Other Names | RFWD1|RNF119|E3 ubiquitin-protein ligase TRAF7|RING finger and WD repeat-containing protein 1|RING finger protein 119|ring finger and WD repeat domain 1|TNF receptor associated factor 7|TRAF7|TNF Receptor-Associated Factor 7|RGD1559653|MGC52680|TNF receptor associated factor 7 S homeolog|traf7.S|im:7149067|zgc:158391|e3 ubiquitin-protein ligase TRAF7-like |
Gene, Accession # | Gene ID: 84231, 360491 |
Catalog # | ABIN634504 |
Price | $1020 |
Order / More Info | TRAF7 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |