Edit |   |
---|---|
Antigenic Specificity | AGO1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-AGO1 polyclonal antibody, unconjugated |
Immunogen | EIF2 C1 antibody was raised using the N terminal of EIF2 1 corresponding to a region with amino acids MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI |
Other Names | EIF2C|EIF2C1|GERP95|Q99|Golgi Endoplasmic Reticulum protein 95 kDa|argonaute 1|argonaute1|eIF-2C 1|eIF2C 1|eukaryotic translation initiation factor 2C|1|hAgo1|protein argonaute-1|putative RNA-binding protein Q99|argonaute 1, RISC catalytic component|AGO1|Eukaryotic Translation Initiation Factor 2C, 1|Ago|Ago-1|CG6671|Dm Ago1|DmelCG6671|MRE20|ago1-1|anon-WO0257455.29|dAGO1|l(2)04845|l(2)4845|l(2)k00208|l(2)k08121|AGO1-PA|AGO1-PB|AGO1-PC|AGO1-PD|ARGONAUTE-1|CG6671-PA|CG6671-PB|CG6671-PC|CG6671-PD|argonaute|argonaute protein 1|mRNA-like ncRNA in embryogenesis 20|PiwiArgonaute family protein meIF2C1|argonaute RISC catalytic component 1|mAgo1|argonaute RISC catalytic subunit 1|GB12654|protein argonaute-2|LOC552062|LOC659936|T1N15.2|T1N15_2|Stabilizer of iron transporter SufD / Polynucleotidyl transferase|DsimGD25729|GD25729|dsim_GLEANR_9718|DsimAGO1-PA|DsimGD25729-PA|GD25729-PA|DsimAGO1|protein argonaute-1-like|LOC100386910|LOC100482671|LOC475337|argonaute RISC catalytic component 3|protein argonaute-3|argonaute 3, RISC catalytic component|AGO3|LOC100055148 |
Gene, Accession # | Gene ID: 26523, 236511, 313594 |
Catalog # | ABIN632044 |
Price | $1020 |
Order / More Info | AGO1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |