Edit |   |
---|---|
Antigenic Specificity | MARCO |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-MARCO polyclonal antibody, unconjugated |
Immunogen | MARCO antibody was raised using the N terminal of MARCO corresponding to a region with amino acids QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL |
Other Names | AI323439|Ly112|Scara2|macrophage receptor MARCO|macrophage receptor with collagenous structure|Marco|scavenger receptor class A member 2|scavenger receptor class A|member 2|putative scavenger receptor MARCO |
Gene, Accession # | Gene ID: 8685 |
Catalog # | ABIN635028 |
Price | $1020 |
Order / More Info | MARCO Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |