Edit |   |
---|---|
Antigenic Specificity | NTRK3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-NTRK3 polyclonal antibody, unconjugated |
Immunogen | NTRK3 antibody was raised using the C terminal of NTRK3 corresponding to a region with amino acids ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG |
Other Names | TRKC|gp145(trkC)|ETS related protein-neurotrophic receptor tyrosine kinase fusion protein|ETV6-NTRK3 fusion|GP145-TrkC|NT-3 growth factor receptor|tyrosine kinase receptor C|neurotrophic receptor tyrosine kinase 3|NTRK3|Neurotrophic tyrosine Kinase, Receptor, Type 3|neural receptor protein-tyrosine kinase (trkC)|trk-C|trkC tyrosine kinase|AW125844|Ntrk3_tv3|neurotrophin-3|neurotrophic tyrosine kinase receptor type 3|tyrosine kinase C receptor|TrkC receptor|high-affinity neurotrophin receptor|neurotrophic tyrosine kinase|receptor|type 3|NT-3 growth factor receptor-like |
Gene, Accession # | Gene ID: 4916, 18213, 29613 |
Catalog # | ABIN635695 |
Price | $1020 |
Order / More Info | NTRK3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |