Edit |   |
---|---|
Antigenic Specificity | PPIA |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PPIA polyclonal antibody, unconjugated |
Immunogen | PPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
Other Names | PPIase A|cyclophilin A|cyclophilin T|cyclophilin T-cell|cyclosporin A-binding protein|peptidyl-prolyl cis-trans isomerase A|rotamase A|peptidylprolyl isomerase A|PPIA|Peptidylprolyl Isomerase A (Cyclophilin A)|Cyp1|PPIA-2|fa93g09|wu:fa93g09|wu:fb05e11|wu:fb13h02|wu:fb15a05|2-peptidylprolyl isomerase A|peptidylprolyl isomerase Aa (cyclophilin A)|ppiaa|cyclophilin 18|CYPA|immunophilin|peptidylprolyl isomerase A (cyclophilin A) L homeolog|ppia.L|cyclophilin-like|CYPH|T cell cyclophilin|cyclophilin|CNB01230|CNB01290|Tc00.1047053506925.300|Tb11.03.0250|CYCA|CyP-A|p1B15|p31|MGC75715|2700098C05|Cphn|CyP-18|SP18|MT-ND1|MTND1|NADH1|ND1|NADH dehydrogenase subunit 1|NADH-ubiquinone oxidoreductase chain 1 |
Gene, Accession # | Gene ID: 5478, 25518, 268373, 403581 |
Catalog # | ABIN629650 |
Price | $902 |
Order / More Info | PPIA Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |