Edit |   |
---|---|
Antigenic Specificity | KHDRBS1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-KHDRBS1 polyclonal antibody, unconjugated |
Immunogen | KHDRBS1 antibody was raised using the N terminal of KHDRBS1 corresponding to a region with amino acids LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKN |
Other Names | Sam68|p62|p68|GAP-associated tyrosine phosphoprotein p62 (Sam68)|KH domain-containing|RNA-binding|signal transduction-associated protein 1|p21 Ras GTPase-activating protein-associated p62|src-associated in mitosis 68 kDa protein|KH RNA binding domain containing, signal transduction associated 1|KHDRBS1|KH Domain Containing, RNA Binding, Signal Transduction Associated 1|fj90g10|wu:fa18g12|wu:fa56c01|wu:fc91b01|wu:fj90g10|zgc:113899|GAP-associated phosphoprotein p62|KH domain containing|RNA binding|signal transduction associated 1|fa18g12|fa56c01|fc91b01|KH domain containing, RNA binding, signal transduction associated 1a|khdrbs1a|GAP-associated tyrosine phosphoprotein p62|src associated in mitosis|68 kDa|KH domain RNA-binding protein Sam68|KH domain containing, RNA binding, signal transduction associated 1 S homeolog|khdrbs1.S |
Gene, Accession # | Gene ID: 10657 |
Catalog # | ABIN634247 |
Price | $1020 |
Order / More Info | KHDRBS1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |