Edit |   |
---|---|
Antigenic Specificity | SLC1A5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SLC1A5 polyclonal antibody, unconjugated |
Immunogen | SLC1 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV |
Other Names | AAAT|ASCT2|ATBO|M7V1|M7VS1|R16|RDRC|ATB(0)|RD114 virus receptor|RD114simian type D retrovirus receptor|baboon M7 virus receptor|neutral amino acid transporter B|neutral amino acid transporter B(0)|sodium-dependent neutral amino acid transporter type 2|solute carrier family 1 member 5|SLC1A5|Slc1a7|ASC-like Na(+)-dependent neutral amino acid transporter ASCT2|insulin-activated amino acid transporter|solute carrier family 1|member 7|solute carrier family 1 (neutral amino acid transporter), member 5|neutral amino acid transporter B0|H4-ASCT2|CAZ-associated structural protein|H4-system ASC-like transporter|sodium-dependent neutral amino acid transporter ASCT2|solute carrier family 1 member 5 S homeolog|slc1a5.S|alanineserinecysteine hreonine transporter 2|amino acid transporter ASCT2|solute carrier family 1 (neutral amino acid transporter)|member 5|LOC100726536|LOW QUALITY PROTEIN: neutral amino acid transporter B(0) |
Gene, Accession # | Gene ID: 6510, 20514, 292657, 484425 |
Catalog # | ABIN630342 |
Price | $902 |
Order / More Info | SLC1A5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |