Edit |   |
---|---|
Antigenic Specificity | UBR2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-UBR2 polyclonal antibody, unconjugated |
Immunogen | UBR2 antibody was raised using the C terminal of UBR2 corresponding to a region with amino acids QGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHAQEANQTLVGIDWQHL |
Other Names | C6orf133|RP3-392M17.3|bA49A4.1|dJ242G1.1|dJ392M17.3|E3 ubiquitin-protein ligase UBR2|ubiquitin-protein ligase E3-alpha-2|ubiquitin-protein ligase E3-alpha-II|ubiquitin protein ligase E3 component n-recognin 2|UBR2|9930021A08Rik|AI462103|AW540746|E130209G04Rik|mKIAA0349|N-recognin-2|ubiquitin ligase E3 alpha-II|si:ch211-239i4.2|ubiquitin protein ligase E3 component n-recognin 2 S homeolog|ubr2.S |
Gene, Accession # | Gene ID: 23304 |
Catalog # | ABIN631224 |
Price | $1020 |
Order / More Info | UBR2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |