Edit |   |
---|---|
Antigenic Specificity | Occludin |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Occludin polyclonal antibody, unconjugated |
Immunogen | Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED |
Other Names | AI503564|Ocl|occludin|Ocln|oclnb|occludin b|occludin S homeolog|ocln.S|tight-junction protein|tpmt|thiopurine methyltransferase|occludin-like|wu:fd23h10|wu:fi13c01|zgc:113992|zgc:56359|occludin a|oclna|BLCPMG|tight junction protein occludin |
Gene, Accession # | Gene ID: 18260, 83497, 403844, 100506658 |
Catalog # | ABIN630294 |
Price | $902 |
Order / More Info | Occludin Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |