Edit |   |
---|---|
Antigenic Specificity | SLC12A1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SLC12A1 polyclonal antibody, unconjugated |
Immunogen | SLC12 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI |
Other Names | BSC1|NKCC2|NKCC2A variant A|Na-K-2Cl cotransporter|bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2|kidney-specific Na-K-Cl symporter|solute carrier family 12 (sodiumpotassiumchloride transporters)|member 1|solute carrier family 12 member 1|SLC12A1|Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1|FERM domain-containing protein 4A|NaKCl cotransporter|si:ch211-220f12.1|DKFZp469A2020|solute carrier family 12|solute carrier family 12 member 1-like|AI788571|D630042G03Rik|mBSC1|urehr3|bumetanide-sensitive cotransporter type 1|solute carrier family 12, member 1|Solute carrier family 12 member 1 (bumetanide-sensitive sodium-potassium-chloride cotransporter)|member 1 (bumetanide-sensitive sodium-potassium-chloride cotransporter)|apical Na(2Cl)K cotransporter |
Gene, Accession # | Gene ID: 6557, 20495, 25065, 478292 |
Catalog # | ABIN632379 |
Price | $1020 |
Order / More Info | SLC12A1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |