Edit |   |
---|---|
Antigenic Specificity | Epidermal Growth Factor Receptor Peptide 8 |
Clone | CPTC-EGFR-5 |
Host Species | Mouse |
Reactive Species | human |
Isotype | IgG1, kappa |
Format | supernatant |
Size | 1 ml |
Concentration | n/a |
Applications | n/a |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | RRID:AB_2722049: RAS pathway related proteins |
Immunogen | Synthetic peptide YSSDPTGALTEDSIDDTFLPVPEYINQSVPK, a.a. 1069-1099 |
Other Names | ERBB, ERBB1 |
Gene, Accession # | EGFR, Gene ID: 1956, UniProt: P00533 |
Catalog # | CPTC-EGFR-5 |
Price | please inquire |
Order / More Info | Epidermal Growth Factor Receptor Peptide 8 Antibody from DEVELOPMENTAL STUDIES HYBRIDOMA BANK |
Product Specific References | n/a |