Edit |   |
---|---|
Antigenic Specificity | AP-2 alpha |
Clone | 3B5 |
Host Species | Mouse |
Reactive Species | chicken, human, mouse, zebrafish |
Isotype | IgG2b, kappa |
Format | supernatant |
Size | 1 ml |
Concentration | n/a |
Applications | Chromatin Immunoprecipitation,FFPE,Gel Supershift,Immunofluorescence,Immunohistochemistry,Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Epitope: AP-2 alpha sequence (amino acids 166-197). AP-2 alpha specific. Does not react with AP-2 beta or AP-2 gamma. Immunoprecipitation also EMSA supershift analysis and ChIP-seq. Immunohistochemistry requires antigen retrieval, {see PMID: 9850080}. Antibody Registry ID: AB_528084 |
Immunogen | AP-2 alpha delta N165, KQSAALCLLRLYRTSPDLVPMGDWTSRVVHLLN |
Other Names | AP-2; BOFS; AP2TF; TFAP2; AP-2alpha |
Gene, Accession # | TFAP2A, Gene ID: 7020, UniProt: P05549 |
Catalog # | 3B5 |
Price | please inquire |
Order / More Info | AP-2 alpha Antibody from DEVELOPMENTAL STUDIES HYBRIDOMA BANK |
Product Specific References | PubMed: 8895516 |