Edit |   |
---|---|
Antigenic Specificity | EPH receptor B4 |
Clone | CPTC-EPHB4-1 |
Host Species | Mouse |
Reactive Species | human, lizard |
Isotype | IgG2b |
Format | supernatant |
Size | 1 ml |
Concentration | n/a |
Applications | ELISA |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Antibody has been characterized only by ELISA or western blot. RRID:AB_2617253 |
Immunogen | Recombinant Domain, SNAPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLD |
Other Names | EPH receptor B4; HTK; MYK1; Hepatoma transmembrane kinase; Tyrosine-protein kinase TYRO11; TYRO11; EC 2.7.10.1; EPHB4; ephrin type-B receptor 4; soluble EPHB4 variant 1; soluble EPHB4 variant 2; soluble EPHB4 variant 3; tyrosine-protein kinase receptor HTK; EC 2.7.10 |
Gene, Accession # | EPHB4, Gene ID: 2050, UniProt: P54760 |
Catalog # | CPTC-EPHB4-1 |
Price | please inquire |
Order / More Info | EPH receptor B4 Antibody from DEVELOPMENTAL STUDIES HYBRIDOMA BANK |
Product Specific References | n/a |