Edit |   |
---|---|
Antigenic Specificity | REEP1 |
Clone | N345/51 |
Host Species | Mouse |
Reactive Species | mouse and rat |
Isotype | IgG2b |
Format | FL594 conjugate |
Size | 200 µL |
Concentration | 0.5 mg/mL |
Applications | ICC, IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse anti-REEP1 monoclonal antibody, FL594 conjugated. Does not cross-react with REEP2. RRID: AB_2940094 |
Immunogen | Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (accession number Q8BGH4) produced recombinantly in E. Coli |
Other Names | Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein) |
Gene, Accession # | Reep1 D6Ertd253e C2orf23 SPG31, UniProt: Q8BGH4 |
Catalog # | 75-313-FL594 |
Price | $460 |
Order / More Info | REEP1 Antibody from NEUROMAB |
Product Specific References | n/a |