Edit |   |
---|---|
Antigenic Specificity | SUR1 and SUR2B |
Clone | N323A/31 |
Host Species | Mouse |
Reactive Species | mouse and rat |
Isotype | IgG1 |
Format | Protein A purified |
Size | 100 µL |
Concentration | 1 mg/mL |
Applications | ICC, IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse anti-SUR1 and SUR2B monoclonal antibody. Cross-reacts with SUR1. RRID: AB_2315926 |
Immunogen | Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B (accession number Q63563-2) produced recombinantly in E. Coli |
Other Names | ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2) |
Gene, Accession # | Abcc8 Sur Sur1 Abcc9 Sur2, UniProt: Q63563-2 |
Catalog # | 75-298 |
Price | $319 |
Order / More Info | SUR1 and SUR2B Antibody from NEUROMAB |
Product Specific References | n/a |