Ataxin-1, 11NQ Antibody from NEUROMAB
Search, find, compare suppliers for anti-Ataxin-1, 11NQ antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Ataxin-1, 11NQ |
| Clone | N76/8 |
| Host Species | Mouse |
| Reactive Species | human, mouse, and rat |
| Isotype | IgG2b |
| Format | FL594 conjugate |
| Size | 200 µL |
| Concentration | 0.5 mg/mL |
| Applications | ICC, IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mouse anti-Ataxin-1, 11NQ monoclonal antibody, FL594 conjugated. No cross-reactivity reported. RRID: AB_2939438 |
| Immunogen | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254) |
| Other Names | Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog) |
| Gene, Accession # | Atxn1 Sca1, UniProt: P54254 |
| Catalog # | 75-117-FL594 |
| Price | $460 |
| Order / More Info | Ataxin-1, 11NQ Antibody from NEUROMAB |
| Product Specific References | n/a |
NEUROMAB
NEUROMAB
Produced and sold by Antibodies Inc.
P.O. Box 1560
Davis CA 95617-1560
P: (530) 758-4400
P: (800) 824-8540
F: (530) 758-6307
info@antibodiesinc.com
Ordering: orders@antibodiesinc.com
https://www.antibodiesinc.com/
Profile of NEUROMAB