REEP1 Antibody from NEUROMAB
Search, find, compare suppliers for anti-REEP1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | REEP1 |
| Clone | N345/51 |
| Host Species | Mouse |
| Reactive Species | mouse and rat |
| Isotype | IgG2b |
| Format | FL490 conjugate |
| Size | 200 µL |
| Concentration | 0.5 mg/mL |
| Applications | ICC, IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mouse anti-REEP1 monoclonal antibody, FL490 conjugated. Does not cross-react with REEP2. RRID: AB_2940092 |
| Immunogen | Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (accession number Q8BGH4) produced recombinantly in E. Coli |
| Other Names | Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein) |
| Gene, Accession # | Reep1 D6Ertd253e C2orf23 SPG31, UniProt: Q8BGH4 |
| Catalog # | 75-313-FL490 |
| Price | $460 |
| Order / More Info | REEP1 Antibody from NEUROMAB |
| Product Specific References | n/a |
NEUROMAB
NEUROMAB
Produced and sold by Antibodies Inc.
P.O. Box 1560
Davis CA 95617-1560
P: (530) 758-4400
P: (800) 824-8540
F: (530) 758-6307
info@antibodiesinc.com
Ordering: orders@antibodiesinc.com
https://www.antibodiesinc.com/
Profile of NEUROMAB