Edit |   |
---|---|
Antigenic Specificity | GluA2/GluR2 Glutamate Receptor |
Clone | L21/32 |
Host Species | Mouse |
Reactive Species | human, mouse, and rat |
Isotype | IgG1 |
Format | FL594 conjugate |
Size | 200 µL |
Concentration | 0.5 mg/mL |
Applications | ICC, IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse anti-GluA2/GluR2 Glutamate Receptor monoclonal antibody, FL594 conjugated. Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results). RRID: AB_2939070 |
Immunogen | Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli |
Other Names | Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2) |
Gene, Accession # | Gria2 Glur2, UniProt: P19491 |
Catalog # | 75-002-FL594 |
Price | $515 |
Order / More Info | GluA2/GluR2 Glutamate Receptor Antibody from NEUROMAB |
Product Specific References | n/a |