Edit |   |
---|---|
Antigenic Specificity | Ataxin-1, 11NQ |
Clone | N76/8 |
Host Species | Mouse |
Reactive Species | human, mouse, and rat |
Isotype | IgG2b |
Format | FL490 conjugate |
Size | 200 µL |
Concentration | 0.5 mg/mL |
Applications | ICC, IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse anti-Ataxin-1, 11NQ monoclonal antibody, FL490 conjugated. No cross-reactivity reported. RRID: AB_2939436 |
Immunogen | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254) |
Other Names | Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog) |
Gene, Accession # | Atxn1 Sca1, UniProt: P54254 |
Catalog # | 75-117-FL490 |
Price | $460 |
Order / More Info | Ataxin-1, 11NQ Antibody from NEUROMAB |
Product Specific References | n/a |